70R-2901

Myosin Ie antibody

934 BGN
Размер: 50 ug
Oписание: Rabbit polyclonal Myosin Ie antibody raised against the middle region of MYO1E
  • "Category: Purified Polyclonal Antibodies"
  • "Research Area: Cell Biology"
  • "Immunogen: Myosin Ie antibody was raised using the middle region of MYO1E corresponding to a region with amino acids PKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDIIKEDPSGWWTGR"
  • "Host: Rabbit"
  • "Specificity: Myosin Ie antibody was raised against the middle region of MYO1E"
  • "Cross Reactivity: Human,Mouse,Rat"
  • "Isotype: NA"
  • "Clone: NA"
  • "Method of Purification: Affinity purified"
  • "Concentration: 1 mg/ml"
  • "Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose."
  • "Applications: WB"
  • "Usage Recommendations: WB: 1 ug/ml"

  • "Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles."
  • "Shipping: Blue Ice"
Contact Form

Ако желаете да получите оферта или имате въпроси за този продукт, моля копирайте линка или каталожния номер когато изпращате запитване.
Ако имате някакви въпроси, моля да се свържете с Гентауър.
За да се срържете с нас:
Телефон: +359 89 745 53 88
Имейл: bulgaria@gentaur.com

Related Products:

Id Title / Description Supplier Size Price
20-abx177686

Myosin IE (MYO1E) Antibody

Abbexa 1 mg, 200 ug 2604 BGN, 1240 BGN
20-abx100604

Myosin IE (MYO1E) Antibody

Abbexa 100 ug, 10 ug, 1 mg, 200 ug, 50 ug 850 BGN, 266 BGN, 2410 BGN, 1156 BGN, 656 BGN
10R-7877

Myosin antibody (smooth)

Fitzgerald 100 ug 644 BGN
70R-50100

Myosin 8 antibody

Fitzgerald 100 ul 488 BGN
abx217017-100ug

Myosin IB (MYO1B) Antibody

Abbexa 100 ug 878 BGN