33R-6834

Myosin Ic Blocking Peptide

360 BGN
Размер: 100 ug
Oписание: A synthetic peptide for use as a blocking control in assays to test for specificity of MYO1C antibody, catalog no. 70R-2182
  • "Category: Blocking Peptides"
  • "Research Area: Cell Biology"
  • "Residues: NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV"
  • "Type: Synthetic"
  • "Form & Buffer: Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml."
  • "Applications: WB, IHC"

  • "Storage: Store at -20°C long term. Avoid repeat freeze-thaw cycles."
  • "Shipping InfoBlue Ice"
Contact Form

Ако желаете да получите оферта или имате въпроси за този продукт, моля копирайте линка или каталожния номер когато изпращате запитване.
Ако имате някакви въпроси, моля да се свържете с Гентауър.
За да се срържете с нас:
Телефон: +359 89 745 53 88
Имейл: bulgaria@gentaur.com

Related Products:

Id Title / Description Supplier Size Price
70R-2182

Myosin Ic antibody

Fitzgerald 50 ug 934 BGN
20-abx005266

Myosin IC (MYO1C) Antibody

Abbexa 100 ul, 200 ul, 20 ul, 50 ul 822 BGN, 1184 BGN, 364 BGN, 628 BGN
KTE30086-96T

ELISA kit for Chicken Myosin-Ic (MYO1C)

Abbkine 96T 1144 BGN
AF4425-BP

Phospho-Myosin IIa (Ser1943) Blocking Peptide

Affbiotech 1mg 390 BGN
3097BP-50

Hsp70 Blocking Peptide

Biovision 306 BGN