70R-2182

Myosin Ic antibody

934 BGN
Размер: 50 ug
Oписание: Rabbit polyclonal Myosin Ic antibody raised against the N terminal of MYO1C
  • "Category: Purified Polyclonal Antibodies"
  • "Research Area: Cell Biology"
  • "Immunogen: Myosin Ic antibody was raised using the N terminal of MYO1C corresponding to a region with amino acids NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV"
  • "Host: Rabbit"
  • "Specificity: Myosin Ic antibody was raised against the N terminal of MYO1C"
  • "Cross Reactivity: Human,Mouse,Rat"
  • "Isotype: NA"
  • "Clone: NA"
  • "Method of Purification: Affinity purified"
  • "Concentration: 1 mg/ml"
  • "Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose."
  • "Applications: WB"
  • "Usage Recommendations: WB: 1 ug/ml"

  • "Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles."
  • "Shipping: Blue Ice"
Contact Form

Ако желаете да получите оферта или имате въпроси за този продукт, моля копирайте линка или каталожния номер когато изпращате запитване.
Ако имате някакви въпроси, моля да се свържете с Гентауър.
За да се срържете с нас:
Телефон: +359 89 745 53 88
Имейл: bulgaria@gentaur.com

Related Products:

Id Title / Description Supplier Size Price
20-abx141925

Myosin Ic (MYO1C) Antibody

Abbexa 100 ul, 200 ul, 50 ul 740 BGN, 1212 BGN, 600 BGN
20-abx100600

Myosin IC (MYO1C) Antibody

Abbexa 100 ug, 10 ug, 1 mg, 200 ug, 50 ug 850 BGN, 266 BGN, 2410 BGN, 1156 BGN, 656 BGN
A2065-5

IC-87114

ApexBio 5 mg 236 BGN
A2065-5.1

IC-87114

ApexBio 10 mM (in 1mL DMSO) 242 BGN
20-abx133518

Myosin 14 Antibody

Abbexa 100 ul, 200 ul, 30 ul 600 BGN, 878 BGN, 378 BGN