33R-1828

KIF2B Blocking Peptide

360 BGN
Размер: 100 ug
Oписание: A synthetic peptide for use as a blocking control in assays to test for specificity of KIF2B antibody, catalog no. 70R-5498
  • "Category: Blocking Peptides"
  • "Research Area: Signal Transduction"
  • "Residues: CVCVRKRPLNQRETTLKDLDIITVPSDNVVMVHESKQKVDLTRYLQNQTF"
  • "Type: Synthetic"
  • "Form & Buffer: Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml."
  • "Applications: WB, IHC"

  • "Storage: Store at -20°C long term. Avoid repeat freeze-thaw cycles."
  • "Shipping InfoBlue Ice"
Contact Form

Ако желаете да получите оферта или имате въпроси за този продукт, моля копирайте линка или каталожния номер когато изпращате запитване.
Ако имате някакви въпроси, моля да се свържете с Гентауър.
За да се срържете с нас:
Телефон: +359 89 745 53 88
Имейл: bulgaria@gentaur.com

Related Products:

Id Title / Description Supplier Size Price
33R-1874

KIF2B Blocking Peptide

Fitzgerald 100 ug 360 BGN
ELI-14146r

Kif2b/ Rat Kif2b ELISA Kit

Lifescience Market 96 Tests 1772 BGN
3037BP-50

RAIDD Blocking Peptide

Biovision 306 BGN
3038BP-50

NFkB Blocking Peptide

Biovision 306 BGN
33R-1822

TM4SF4 Blocking Peptide

Fitzgerald 100 ug 360 BGN